PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2AS_FA7059723.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 349aa    MW: 38633.5 Da    PI: 6.4153
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2AS_FA7059723.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.5e-181461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+eEde+lv ++k++G g+W+t +r   + R++k+c++rw +yl
  Traes_2AS_FA7059723.1 14 KGPWTQEEDEKLVAYIKKHGQGNWRTLPRNADLERCGKSCRLRWTNYL 61
                           79********************************************97 PP

2Myb_DNA-binding54.62.6e-1767111147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
  Traes_2AS_FA7059723.1  67 RGRFSFEEEETIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                            89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-24564IPR009057Homeodomain-like
PROSITE profilePS5129418.431961IPR017930Myb domain
SuperFamilySSF466894.12E-3111108IPR009057Homeodomain-like
SMARTSM007179.0E-151363IPR001005SANT/Myb domain
PfamPF002494.4E-151461IPR001005SANT/Myb domain
CDDcd001672.16E-121661No hitNo description
PROSITE profilePS5129425.25562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-2665116IPR009057Homeodomain-like
SMARTSM007171.8E-1666114IPR001005SANT/Myb domain
PfamPF002491.1E-1567111IPR001005SANT/Myb domain
CDDcd001672.07E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MGRAPCCDRT GLKKGPWTQE EDEKLVAYIK KHGQGNWRTL PRNADLERCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHAPRL DLLDLSSLLK PAAYYPTQAD LDTLRALEPL ANYPDLLRLA STLLAAPTTT  180
SSQPTTEQQM LLPWLIQAQM AQQVSQAPPQ HATAADMFLQ PSSACQMPGL VHANPAQQLH  240
QDHMVPSDYG QLPGYDNQLE LDYVPALMQM ASDTSNLQWS SPVTSSNNNN NCNVGSGVST  300
PSSSPAGRVN SASPTTFCAN ASNIDAFSAD AAGLFDMHLS DLLDVSDYM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-31121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2485790.0AK248579.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf97l09, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006657827.11e-166PREDICTED: transcription factor MYB39-like
TrEMBLW5B5Z30.0W5B5Z3_WHEAT; Uncharacterized protein
STRINGMLOC_62436.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.17e-86MYB-like 102
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]